Customer service:Sequence , MSLKNNIVGFNKLDSEELKNINGGCYPLLIIGALAGIAIRNRIKK 90% purity, 5 MG

https://www.rd-hope.de/web/image/product.template/6187/image_1920?unique=5bc509a

700.00 € 700.0 EUR 700.00 €

700.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days